Sermorelin Acetate 10mg lyophilised peptide vial

NovaPep

Buy Sermorelin Australia: Sermorelin 10mg Research Vial

$89AUD, GST included

In stock in Australia, batch certificate ready

Size: 10 mg vial

Certificate of analysis published for every batch
Third-party HPLC purity and MS identity testing
Dispatched same day before 3pm cut-off, tracked Australia-wide
Research use only, sold to adults aged 18 and over

Buy sermorelin Australia stock online from NovaPep as a 10 mg research vial, tested for identity and purity on every lot. Sermorelin is GHRH (1-29) amide, the opening 29 residues of human growth hormone releasing hormone with nothing substituted, and NovaPep stocks sermorelin in Australia for laboratory research. It switches on the GHRH receptor of pituitary somatotrophs in the same way as the natural sequence, which makes it the standard native reference for GHRH pathway studies. Reference identity data are C149H246N44O42S, 3357.9 g/mol and CAS 86168-78-7. Every batch is tested by mass spectrometry for identity and HPLC for purity, so you can review the lot report in the COA library before payment. Use the peptide calculator to convert the diluent volume you add into a concentration. To set the native fragment against its stabilised cousin, compare it with CJC-1295 No DAC. The vial holds powder alone, so add bacteriostatic water to your order. Keep the unopened sermorelin vial at -20 °C out of the light. Supplied as an in vitro laboratory research reagent to buyers 18 years or older.

For laboratory research use only. Not for human or veterinary use. Not TGA approved. See the NovaPep research use policy.

What Is Sermorelin?

Sermorelin is a synthetic replica of the first 29 amino acids of the body's own signal for releasing growth hormone, kept exactly as the natural sequence reads. It is the shortest fragment of GHRH that retains full potency, so the sermorelin peptide offers the simplest route to activating the GHRH receptor in a pituitary model. Buy sermorelin online in Australia as a 10 mg research vial, with the lot certificate published before you order.

Sermorelin preserves residues 1 to 29 of human GHRH with no substitutions at all, from the first tyrosine through to the amidated arginine. Methionine 27 contributes the sulphur that puts an S in the formula, and it is also the vulnerable spot because it can oxidise. The acetate counter-ion leaves the active chain unchanged, and the identity figures describe the peptide alone.

Discovered in a Tumour Rather Than the Brain

Sermorelin has an unusual origin. For decades physiologists believed the hypothalamus released a factor that triggered growth hormone, yet brain tissue held far too little of it to isolate. The answer turned up in the pancreas instead. A few patients with acromegaly had rare pancreatic tumours that secreted a hormone driving their pituitaries to make excess growth hormone. Two teams at the Salk Institute, one headed by Roger Guillemin and the other by Wylie Vale and Jean Rivier, sequenced this hormone from the tumour tissue in 1982. It turned out to be the same as the hypothalamic hormone. Before long, truncation work revealed that the leading 29 residues, ending in an amide, were as active as the complete 44.

When GHRH was isolated in 1982 it was a 44 amino acid hormone, and structural studies quickly established that the amidated 1-29 portion accounted for most of its activity. That synthetic piece became sermorelin, registered in the United States under the name Geref and used to assess pituitary growth hormone reserve until it was withdrawn from sale. It acts only briefly, with a half-life of about 10 to 20 minutes, and that short action is exactly why it works so well as a baseline. Now it is a widely used laboratory reagent.

How Sermorelin Works at the GHRH Receptor

Most of the activity is encoded at the amino terminus. Receptor activation depends on the first few residues, tyrosine, alanine and aspartic acid, while the rest of the chain folds into a helix that anchors the peptide in the binding pocket. This also explains its fragility, because DPP-4 cleaves right at that activating end. After binding, the receptor lifts cyclic AMP inside the somatotroph and growth hormone is released as a short pulse that tracks the timing of the stimulus.

It binds GHRHR, a Gs-coupled receptor that increases cAMP inside somatotrophs. Further downstream, the growth hormone released drives hepatic IGF-1, which is the marker most GH axis studies measure.

Sermorelin Research: What Studies Have Looked At

Human studies of the fragment predate most of the peptide literature. Corpas and co-workers ran a small clinical study in 1992, giving GHRH 1-29 to older men for two weeks. At the higher of the two doses their 24-hour growth hormone and IGF-1 climbed to levels indistinguishable from those of young men. The paper is still quoted as evidence that an ageing pituitary retains a reserve that an appropriate signal can tap. To run this kind of in vitro work, buy sermorelin online in Australia from lots tested by HPLC and mass spectrometry.

Here is our take on the role of sermorelin acetate in a lab today. It serves as the yardstick every later analogue is quietly compared with. Whatever is claimed for Mod GRF, tesamorelin or the DAC conjugate is a claim of improvement on the native fragment, and the strongest proof is to include the original on the same plate. Our guide comparing the GHRH analogue family lines up all four.

Sermorelin gives a lab an unaltered reference point for the GHRH pathway, whether to characterise the receptor, gauge pituitary secretory capacity in ageing models or compare newer analogues with the original. NovaPep supplies it as a research reagent, not a medicine, in our GH peptide category.

From Geref to a Laboratory Reagent

Unlike most items in our growth hormone range, sermorelin was once a finished medicine. Serono marketed it in the United States as Geref, approved in 1997 for idiopathic growth hormone deficiency in children with growth failure, along with a diagnostic form for testing pituitary reserve. In 2008 EMD Serono informed the FDA that it would discontinue the product, and the approvals were withdrawn in June 2009. The FDA later determined that the withdrawal was not due to safety or effectiveness concerns.

Sermorelin Specifications

Product	Sermorelin acetate
Size	10 mg vial
Structure or sequence	YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, human GHRH (1-29) amide
Chain length	29 amino acids
Formula	C149H246N44O42S (peptide)
Molar mass	3357.9 g/mol (free base)
CAS	86168-78-7
Format	Freeze-dried acetate salt in a sealed glass vial
Analysis	Identity by mass spectrometry, purity by HPLC, with a certificate for every lot
In the box	A single vial of 10 mg sermorelin acetate, sent without diluent (bacteriostatic water sold separately)
Storage	Unopened at -20 °C protected from light and humidity, solution at 2 to 8 °C for a short time only
Stock	In stock
Intended use	Laboratory in vitro research only

Sermorelin is the right reagent when a study calls for GHRH receptor activation by the untouched native sequence. Each 10 mg lot has its own HPLC result, and the sections below cover identity checks, handling and how it compares with stabilised analogues.

Inside the vial is 10 mg of sermorelin acetate as a white lyophilised powder. The acetate is simply the counter-ion remaining after purification, not an additional ingredient.

Since sermorelin and Mod GRF (1-29) are built on the same backbone, mass is what settles identity. A reading close to 3357.9 g/mol confirms sermorelin, whereas one close to 3367.9 g/mol would indicate the stabilised analogue. Find your lot in the certificate archive and read it alongside our guide to COA interpretation.

Handling and Storage of Sermorelin

Handling is governed by two vulnerabilities. DPP-4 cleaves the Ala2-Asp3 bond within minutes, and Met27 is prone to oxidation. Only reconstitute when you need to, letting bacteriostatic water run down the glass with no agitation. Putting 2.5 mL into the 10 mg vial gives 4 mg/mL, and the concentration calculator handles any other volume. When you buy sermorelin online in Australia, orders paid by 3pm on a business day are dispatched the same afternoon.

Keep the powder at -20 °C in darkness until you use it. Solution should be stored at 2 to 8 °C, and because the native sequence is less robust than its analogues, it is sensible to split it into aliquots and use it up well inside 28 days. Mark each aliquot with the lot number and the date it was mixed so every result links back to the correct certificate.

Sermorelin Compared With CJC-1295 No DAC and Ipamorelin

CJC-1295 No DAC, also known as the Mod GRF (1-29) analogue, keeps the same 29 residue frame but adds four DPP-4 resistant substitutions, extending its half-life to about 30 minutes compared with the 10 to 20 minutes reported for sermorelin. Choose sermorelin when the native sequence is central to the study, and the stabilised version when a longer window outweighs faithfulness to the natural hormone.

Ipamorelin acts on an entirely different receptor, the ghrelin receptor GHS-R1a, and is available as a 10 mg vial. A sermorelin ipamorelin CJC 1295 design addresses both pituitary inputs, using a native and a stabilised GHRH arm. Tesamorelin offers a third GHRH approach, retaining all 44 residues behind an N-terminal cap, and sermorelin stays the cheapest way to include an unmodified control in that comparison.

Other Names for Sermorelin

You may see sermorelin acetate listed as GRF (1-29) NH2, GHRH (1-29) amide, somatorelin fragment 1-29 or under Geref, its former US brand. Older literature sometimes refers to the parent hormone as somatocrinin or growth hormone releasing factor, the source of the GRF abbreviation.

Buy Sermorelin Online in Australia

Sermorelin comes in one fill, a 10 mg vial. Per milligram that is slightly more than the stabilised CJC-1295 No DAC vial and less than tesamorelin in the same fill. Ten milligrams is the standard research size for GHRH (1-29) peptides, and because the native sequence is delicate, many labs reconstitute only a portion of their stock at once and leave the other vials sealed.

Many searches ask for the best sermorelin peptide, the best sermorelin peptide company or the best place to buy sermorelin peptide. Whichever sermorelin peptide best brand list you read, judge it by the lot certificate behind it.

Where stock allows, every sermorelin vial in an order is drawn from one lot, leaving a single certificate to file for the entire series. Buyers must confirm they are 18 or over and agree to the research use terms before purchase.

You will not find sermorelin at a counter or collection point. Buying online is the only option, the store supplies labs from Perth to Hobart, and all orders ship from a single domestic stock. Customers ordering research peptides in Perth receive exactly the same lots as eastern labs. When payment clears before 3pm on a business day the order is dispatched the same day, and transit times are listed on the delivery information page.

Sermorelin Legal Status in Australia

Is sermorelin legal in Australia? It is a prescription-only substance without any product available. The June 2026 Poisons Standard, still in force in October 2026, gives sermorelin its own Schedule 4 entry. In addition, Appendix D, clause 5, which prohibits possession without authority, covers growth hormone releasing hormones "including those separately specified in Schedule 4", and that wording captures sermorelin too. A TGA product information search for either sermorelin or Geref returns no document, and we could find no current ARTG registration, so Australian prescribers have no registered sermorelin product available to them.

In sport, the WADA 2026 list includes sermorelin as a GHRH analogue in class S2, together with CJC-1295 and tesamorelin, and Sport Integrity Australia enforces that ban at all times.

Because the molecule is well known yet pharmacy shelves are empty, sermorelin in Australia is supplied through research companies. Our 10 mg vial is one of those reagents. It is stocked in Australia, sold to customers aged 18 or older, and meant for in vitro study, never for use in people or animals. Labs working with the complete 44 residue hormone can set it against the tesamorelin vials in three sizes.

Sermorelin Acetate at a Glance

Native GHRH (1-29), Unaltered

Sermorelin consists of the first 29 residues of human GHRH ending in a C-terminal amide, with no substitutions. It binds the same receptor as the full-length hormone.

Buy the 10 mg Vial online

Each sealed 10 mg vial of sermorelin acetate ships from stock in Australia. Diluent is not included, so add bacteriostatic water.

Baseline for GHRH Receptor Studies

Labs use it to characterise the GHRH receptor and pituitary growth hormone reserve, and as the reference point for newer analogues. For research use only.

Versus Mod GRF (1-29)

CJC-1295 No DAC carries four protective substitutions and lasts around 30 minutes. Sermorelin is the natural sequence and acts for 10 to 20 minutes.

Reconstitute Late, Keep Cold

Hold the powder at -20 °C. Because the native chain is delicate in solution, mix only when required and store aliquots at 2 to 8 °C.

Every Lot Mass Verified

Mass spectrometry distinguishes sermorelin from Mod GRF and HPLC records purity. All lot certificates are published in the COA library.

Sermorelin Acetate FAQ

What is sermorelin?

Sermorelin is a synthetic copy of the first 29 amino acids of human growth hormone releasing hormone, ending in an amide. It is the shortest GHRH fragment that keeps full potency. It was first sequenced from pancreatic tumour tissue at the Salk Institute in 1982.

How does sermorelin work?

It binds GHRHR, a Gs-coupled receptor on pituitary somatotrophs, and raises cyclic AMP inside the cell. Growth hormone is then released as a short pulse, and downstream IGF-1 is the marker most studies measure. Its first few residues drive activation, which is also where DPP-4 cleaves it.

How is sermorelin used in the laboratory?

Sermorelin is a research reagent that activates the GHRH receptor with the unaltered sequence, used to study pituitary growth hormone release and to benchmark stabilised analogues. It is not a medicine, has no TGA approval and is supplied only for in vitro and laboratory research to adults 18 and over.

Ipamorelin vs sermorelin, how do they differ in the lab?

Sermorelin is the native GHRH (1-29) fragment and stimulates the GHRH receptor for 10 to 20 minutes. Ipamorelin is a five residue agonist of the ghrelin receptor GHS-R1a, available as a 10 mg vial. Each reaches the pituitary by a different path, so many labs buy both to compare the two inputs.

What makes sermorelin need careful handling?

The native sequence lacks protective substitutions, so DPP-4 breaks it down quickly and methionine 27 is liable to oxidise. Store the powder frozen at -20 °C, reconstitute only once the work is ready to start, do not shake it, and keep the solution at 2 to 8 °C in aliquots for a short time.

What is the way to order sermorelin online in Australia?

Put the 10 mg sermorelin acetate vial in your cart here and finish checkout. It is stocked in Australia, so if payment clears before 3pm on a business day the vial is shipped that day. Since the vial contains only powder, add bacteriostatic water to the order.