Tesamorelin 5mg lyophilised peptide vial

NovaPep

Buy Tesamorelin Australia: Tesamorelin 5mg, 10mg and 20mg Research Vials

$89.99AUD, GST included

In stock in Australia, batch certificate ready

Certificate of analysis published for every batch
Third-party HPLC purity and MS identity testing
Dispatched same day before 3pm cut-off, tracked Australia-wide
Research use only, sold to adults aged 18 and over

Buy tesamorelin peptides online from NovaPep, with tesamorelin Australia stock in 5 mg, 10 mg and 20 mg research vials and tesamorelin 10mg the most popular size. Tesamorelin, first developed under the code TH9507 and now held for research in Australia, is a GHRH analogue that retains every one of the 44 amino acids in human growth hormone releasing hormone. It carries a trans-3-hexenoyl group on its N-terminal tyrosine, and that cap protects it from DPP-4 cleavage as it binds the GHRH receptor on the pituitary, so it is studied as a longer lasting form of the full hormone. The identity figures are C221H366N72O67S, 5135.9 g/mol and CAS 218949-48-5. Mass spectrometry confirms each lot, HPLC measures it, and its certificate of analysis is viewable in the COA library ahead of checkout. Our tesamorelin calculator turns your chosen diluent volume into a working concentration. To compare the full chain with the native 29 residue fragment, see sermorelin. The vials arrive as dry powder without diluent, so include bacteriostatic water. Keep unopened vials at -20 °C, protected from light. NovaPep supplies tesamorelin as a laboratory reagent for in vitro research and sells it only to buyers aged 18 years or older.

For laboratory research use only. Not for human or veterinary use. Not TGA approved. See the NovaPep research use policy.

What Is Tesamorelin?

Tesamorelin is a synthetic version of GHRH, the 44-amino-acid hormone that turns on growth hormone production, with a small fatty cap fixed to its front end so enzymes cannot break it apart immediately. The pituitary responds by releasing growth hormone in its normal pattern. Among all the GHRH analogues available, this is the only one backed by a completed phase 3 programme. Tesamorelin is for sale in Australia as a 5 mg, 10 mg or 20 mg research vial, ready to order online from local stock.

Theratechnologies in Montreal created tesamorelin by retaining the entire 44 residue human hormone and fixing one hexenoyl cap to its first amino acid. DPP-4 cleaves native GHRH within minutes, and the cap slows that process while keeping receptor binding intact. The United States approved the compound in 2010 as Egrifta for a narrow indication, and the trial record behind that approval helps explain why tesamorelin features so heavily in published GH axis research.

How Tesamorelin Works at the GHRH Receptor

The enzyme DPP-4 cuts native GHRH between its second and third residues, alanine and aspartic acid, leaving a shortened chain that is almost inactive. Tesamorelin counters this with a trans-3-hexenoyl group, a six-carbon acyl chain containing one double bond, attached to the first tyrosine. The cap does not touch the surface that binds the receptor, so the molecule still fits the GHRH receptor on somatotrophs and still sets off the cyclic AMP signal that releases stored growth hormone.

Researchers find this approach appealing because it preserves the feedback loop. Supplying growth hormone directly bypasses the system. A GHRH agonist acts further upstream, which means somatostatin and IGF-1 can still restrain the pituitary and output remains pulsatile instead of constant.

It targets the GHRH receptor, GHRHR, found on pituitary somatotrophs. Further down the axis, papers abbreviate growth hormone as GH and insulin-like growth factor 1 as IGF-1, the marker made in the liver that most studies track. No matter which name a protocol uses, the identity check is unchanged, a 44 residue chain with a mass close to 5135.9 g/mol.

Tesamorelin Research: What Studies Have Looked At

Findings from the clinical trials

The most widely cited data come from a 2007 trial in the New England Journal of Medicine by Falutz and colleagues. In it, 412 adults living with HIV who had accumulated abdominal fat were randomly assigned, 275 receiving tesamorelin and 137 receiving placebo, for 26 weeks, with visceral fat measured by CT scan at abdominal level. Visceral fat area dropped by 27.8 square centimetres in the treated group and increased by 5.1 square centimetres on placebo, and the authors noted improved lipid profiles as well. Stanley and colleagues later extended the research to liver fat in the same population. All of these studies were carried out in an HIV setting, and none of them describe the compound beyond it. Shop Tesamorelin online in Australia for this research, knowing each lot has been checked for identity and purity.

Here is our practical advice. Since tesamorelin is the only GHRH analogue supported by large controlled trials, it is the most defensible reference agonist when your results need to be read alongside clinical literature. Work in moles rather than milligrams. With a molar mass of 5135.9 g/mol it is roughly 1.5 times heavier than sermorelin, so matching moles needs about half as much mass again. Labs looking for the best peptide to combine with tesamorelin will find the ghrelin receptor partner already mixed in the tesamorelin and ipamorelin vial.

In the lab, it addresses what the full hormone does at the GHRH receptor when it lasts long enough to be measured. NovaPep sells it as a research reagent with no therapeutic status and no TGA approval, listed with our growth hormone peptides. Each tesamorelin peptide Australia order comes from the same tested stock, regardless of the fill you select.

From TH9507 to Egrifta

Theratechnologies moved the compound, then known as TH9507, through phase 3 trials during the 2000s. On 10 November 2010 the US Food and Drug Administration approved it as Egrifta to reduce excess abdominal fat in adults with HIV-associated lipodystrophy. Two reformulations came later in the United States, Egrifta SV and then Egrifta WR, which was cleared in March 2025. The European application was withdrawn in 2012 before any decision was made.

Tesamorelin Specifications

Product name	Tesamorelin
Sizes	5 mg vial, 10 mg vial, 20 mg vial
Structure	Human GHRH (1-44) amide with a trans-3-hexenoyl group on Tyr1
Peptide length	44 amino acids
Formula	C221H366N72O67S
Molar mass	5135.9 g/mol
CAS	218949-48-5
Presentation	Freeze-dried powder, sealed glass vial fitted with a rubber stopper and flip-off cap
Quality testing	Identity confirmed by mass spectrometry and purity by HPLC, a certificate issued per lot
In the box	A single 5 mg, 10 mg or 20 mg tesamorelin vial with no diluent (bacteriostatic water is sold on its own)
Storage conditions	-20 °C while sealed, dry and dark, then 2 to 8 °C once reconstituted
Stock status	In stock
Intended use	Laboratory in vitro research only

Choose tesamorelin when your project calls for the entire GHRH sequence instead of a shortened fragment. We keep three fill sizes in Australian stock, HPLC documents every lot, and the sizing advice further down helps you match a vial to your study.

All three fills, 5 mg, 10 mg and 20 mg, contain the same white lyophilised powder with nothing added, ready for whatever diluent you prefer.

The sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2, carrying the trans-3-hexenoyl group on Tyr1. A 44 residue chain gives synthesis more chances to produce deletion or truncated sequences than a short peptide would, and these close relatives can elute near the main HPLC peak. For that reason the mass result is just as important as the purity value.

Check that your certificate shows a mass consistent with 5135.9 g/mol together with an HPLC result for the lot printed on your vial. Reports are filed by lot number in the COA library, and our guide to reading a COA shows how the two results relate.

Handling and Storage of Tesamorelin

To reconstitute, let the vial warm to room temperature, add bacteriostatic water slowly down the glass and swirl it instead of shaking. For instance, 2 mL in the 10 mg vial gives 5 mg/mL. The tesamorelin calculator works for the 5 mg and 20 mg fills and for any other volume. Tesamorelin for sale in Australia leaves our shelves by tracked post, so it reaches your bench in good condition.

Unopened vials last best at -20 °C inside their carton. Move mixed solution to 2 to 8 °C and use it within 28 days, and aliquots protect the stock from being handled again and again. Our storage guide explains how powder stability differs from solution stability.

Tesamorelin Compared With Sermorelin

Sermorelin is the unprotected native GHRH (1-29) amide, sold as a 10 mg vial, and its activity lasts only a few minutes. Tesamorelin retains the 15 additional residues and adds the cap, which makes it longer and better at resisting enzymatic breakdown. Sermorelin fits studies needing the unmodified fragment as a control, and tesamorelin fits studies of the full hormone. Both are supplied as powder and reconstitute the same way.

If you also want a ghrelin receptor signal in one vial, choose the tesamorelin and ipamorelin blend, which contains 13 mg plus 3 mg.

Other Names for Tesamorelin

In development papers tesamorelin appears as TH9507, it is called tesamorelin acetate when supplied as the acetate salt, and regulatory records use the brand name Egrifta. Its chemical description is N-(trans-3-hexenoyl)-GHRH (1-44) amide, or more informally a stabilised human GRF analogue.

Buy Tesamorelin Online in Australia

Choosing tesamorelin really comes down to fill size, as all three vials hold the same peptide made to a single specification. The 5 mg vial works for a pilot run or a handling trial. The 10 mg vial is the standard research size and the most common first purchase, because twice the material adds very little to the cost. The 20 mg vial gives the best value once your protocol is fixed and you can use the whole fill within 28 days of mixing.

Buy several vials of one size in one checkout and, where stock permits, they come from the same lot with the same certificate. Labs that are unsure which size to choose generally begin with 10 mg and move up when the method is proven. Only adults aged 18 and over can complete checkout.

NovaPep trades online only with no walk-in counter, so all orders ship from a single domestic stock to every state and territory. When payment reaches us before 3pm on a business day the vial leaves that afternoon, and you can follow its progress through order tracking. Labs that need research peptides in Hobart are served from that same stock.

How Australian Regulations Treat Tesamorelin

No tesamorelin medicine ever reached Australia. As of October 2026 the TGA's product information repository returns no document for tesamorelin or Egrifta, we found no ARTG registration, and there is no pharmacy product available on prescription. Tesamorelin is not named individually in the Poisons Standard, and it does not have to be. The June 2026 instrument lists growth hormone releasing hormones as a class in Schedule 4 and in Appendix D, clause 5, and a GHRH (1-44) analogue falls clearly within that class. As a result, research suppliers are the only practical source of tesamorelin for Australian laboratories.

On its 2026 Prohibited List, WADA names tesamorelin alongside sermorelin and CJC-1295 in the GHRH analogue group of class S2, and Sport Integrity Australia enforces that ban at all times.

Every size of tesamorelin for sale on this page is held in NovaPep's Australian stock as a laboratory reagent. Checkout is limited to adults, and use is restricted to in vitro research, never people or animals. Teams wanting a shorter GHRH comparator often add CJC-1295 No DAC in its 10 mg vial.

More on Buying Tesamorelin in Australia

What size tesamorelin vial is right for my order?

For most first orders the 10 mg vial works well and offers good value per mg. Choose 5 mg for an inexpensive pilot, or 20 mg, the lowest cost per mg, for a fixed, longer series. Select the size your lab can use within 28 days of mixing, because solution keeps less well than powder.

Tesamorelin at a Glance

The Full GHRH Sequence With a Protective Cap

Tesamorelin contains all 44 residues of human GHRH plus a hexenoyl cap on the first amino acid. That cap slows enzyme cleavage while leaving receptor binding unchanged.

Buy 5, 10 or 20 mg Online

Sealed vials of lyophilised powder in three sizes, shipped from Australian stock. Diluent is not included, so put bacteriostatic water in your cart.

For GHRH Receptor Research

Researched for GHRH receptor activation, pulsatile growth hormone release and the IGF-1 axis. Sold strictly for in vitro and laboratory use.

Compared With Sermorelin

Sermorelin is the uncapped 29 residue fragment and works for minutes. Tesamorelin is longer, capped and better protected from breakdown.

Freeze First, Then Refrigerate

Store unopened vials at -20 °C. After mixing, keep the solution at 2 to 8 °C, split it into aliquots and finish it within 28 days.

Certificates for Every Lot

Each lot goes through mass spectrometry and HPLC, and you can view the certificate in the COA library before you order.

Tesamorelin FAQ

What is tesamorelin and how does it work?

Tesamorelin is a synthetic GHRH (1-44) analogue with a trans-3-hexenoyl cap on its first tyrosine. The cap slows DPP-4 cleavage without touching the surface that binds the receptor. It activates the GHRH receptor on somatotrophs, and the cyclic AMP signal releases growth hormone in its normal pulsatile pattern.

How does tesamorelin differ from sermorelin?

Tesamorelin carries the full 44 residue GHRH sequence in a capped form that resists fast breakdown. Sermorelin, a 10 mg vial, is the unmodified 29 residue fragment, used as a control or to repeat earlier work. Some laboratories run both for a direct comparison.

What are the best peptides to stack with tesamorelin in a research order?

For comparison work, the best peptide to stack with tesamorelin is usually ipamorelin, because it brings in a ghrelin receptor input, while sermorelin and CJC-1295 No DAC serve as shorter GHRH controls. If you want ipamorelin premixed, our tesamorelin and ipamorelin blend holds the pair at 13 mg to 3 mg. Every one of these is sold for laboratory research only.

What is the best way to take tesamorelin peptide?

NovaPep cannot answer that for people, because our vials are research reagents and never for human or veterinary use. We give no administration or dosing advice. In the lab, reconstitute with bacteriostatic water, keep the solution at 2 to 8 °C and use the calculator for concentration. Ready to order tesamorelin? Buy the 5, 10 or 20 mg vial with its certificate open before checkout.

What is the best place to buy tesamorelin peptide in Australia?

Choose a supplier that shows the lot certificate before payment and ships from stock held in Australia. The best tesamorelin peptide for research is one where you can match the mass and purity to the vial label. NovaPep operates online only, without a physical shop, and sends the same tested lots to every state and territory.

Is a certificate of analysis supplied with tesamorelin?

Yes. Mass spectrometry confirms each lot against the expected 5135.9 g/mol and HPLC measures its purity. The certificate shows the lot number printed on your vial and can be opened in the COA library whenever you like, including before purchase.